Home | Products | Suppliers | Post selling leads | MSDS Make Me Home | Page Add to Favorite
GL Biochem(Shanghai) Ltd
Home > Supplier Listing > G > GL Biochem(Shanghai) Ltd

Company Information

  • Company Name:

    GL Biochem(Shanghai) Ltd

  • Phone Number:86-21-61263452
  • Fax Number:86-21-61263399

Products

  • 121080-95-3 Boc-D-Cit-OH 122018-91-1 TRH-Potentiating Peptide
  • 122879-69-0 Endothelin 2, human;CSCSSWLDKECVYFCHLDIIW(Disulfidebridge:1-15and3-11) 123025-94-5 Prepro VIP (111-122) (huMan)
  • 123063-31-0 CYS-SER-ARG-ALA-ARG-LYS-GLN-ALA-ALA-SER- ILE-LYS-VA 123622-48-0 Fmoc-5-Ava-OH
  • 124123-15-5 PACAP (1-38), amide, human, ovine, rat;HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2 124882-74-2 fa-gly-oh
  • 125448-83-1 (Cys(AcM)2.7)-α-CGRP (huMan) 125692-40-2 Endothelin 3, human, rat;CTCFTYKDKECVYYCHLDIIW(Disulfidebridge:1-15and3-11)
  • 126370-52-3 cAMP-Dependent Protein Kinase Inhibitor, PKI-tide;IAAGRTGRRQAIHDILVAA 127134-13-8 HIV Protease FRET Substrate I;DABCYL-GABA-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-EDANS
  • 130587-39-2 IL-1β (208-240) (huMan) Interleukin-1β (208-240) (huMan) 131438-74-9 Beta-Amyloid (1-38);DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
  • 131580-10-4 Beta-Amyloid (1-16);DAEFRHDSGYEVHHQK 132917-49-8 α-CGRP (30-37) (canine, Mouse, rat)
  • 133565-46-5 Fmoc-Ile-ol 13512-59-9 Boc-Tyr(Bzl)-ONP
  • 136625-03-1 Boc-Arg(Mts)-OH 141459-28-1 [Cys3,6, Tyr8, Pro9]-Substance P;RPCPQCFYPLM-NH2(Disulfidebridge:3-6)
  • 142985-02-2 (β-Asp3)-GRF (huMan) (β-Asp3)-GHRH (huMan), (β-Asp3)-Growth HorMone-Releasing Factor (huMan), (β-Asp3)-Growth HorMone-Releasing HorMone (huMan), (β-Asp3)-SoMatocrinin (huMan), (β-Asp3)-SoMatoliberin (huMan), (β-Asp3)-SoMatorelin 142988-22-5 Renin FRET Substrate I;(DABCYL-g-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr-EDANS)
  • 144409-99-4 Beta-Amyloid (40-1);VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD 146346-81-8 Fmoc-Ser(TBDMS)-OH

Contact the Supplier

 
CAS NO.:   
* Purchase Request:   
* Your Email:   
* Requirements:   
* Name:   
* Gender:    Male Female
* Country/Area:     
* Company Name:   
* Tel:    - -

Country - Code Area - Code Number

* Explained in detail:   

MSDS

MSDS are normally produced by the manufacturer of the product. So any customer can get the MSDS from the manufacturer/supplier of the product. Some universities and businesses have a collection somewhere on their website. We will give some internet-sources MSDS contain information on the properties of chemicals. Mainly they contain basic information to insure the safety and health of the user at all stages of its manufacture, storage, use and disposal.

MSDS Documents

SourcesDocuments
    • 1.
    • J.T.Baker

      www.jtbaker.com/msds/englishhtml/C4895.htm

    • 2.
    • Acros Organics

      www.acros.com

    • 3.
    • Bio Agri Mix

      www.bioagrimix.com/msds/36/36280/3628051.pdf

    • 4.
    • Sigma-Aldrich

      www.sigmaaldrich.com

    • 5.
    • Science Lab

      www.sciencelab.com/msds.php?msdsId=9923163

    • 6.
    • Sigma-Aldrich

      www.sigmaaldrich.com

Related Suppliers: GL Biochem(Shanghai)Ltd.; GL biochem(shanghai) Ltd; GL Biochem (Shanghai) Ltd.; Shanghai GL Peptide Ltd; GL Peptide (Shanghai) Co., Ltd.; Shanghai Union Biochem Co., Ltd.; Shanghai Dongyue Biochem Co., Ltd.,; GL&S Asia Co Ltd.; Shanghai Garden Biochem Technology Co.,LTD; Achiever Biochem Co., Ltd.; Mollt Biochem Co., Ltd; H&J BioChem Co., Ltd.; Shanghai ChemVia Co., Ltd; Shanghai Zabchem Co.,Ltd.; Shanghai Uchem Co., Ltd.; Shanghai Zealandchem Co., Ltd.; BETAPHARMA(SHANGHAI)CO.,LTD; Dynea (Shanghai) Co., Ltd.; GrowingChem (Shanghai) Co., Ltd.; Hotechem Shanghai Co., Ltd;
Chemicals : A B C D E F G H I J K L M N O P Q R S T U V W X Y Z 0 1 2 3 4 5 6 7 8 9