Products

121080-95-3 Boc-D-Cit-OH 122018-91-1 TRH-Potentiating Peptide
122879-69-0 Endothelin 2, human;CSCSSWLDKECVYFCHLDIIW(Disulfidebridge:1-15and3-11) 123025-94-5 Prepro VIP (111-122) (huMan)
123063-31-0 CYS-SER-ARG-ALA-ARG-LYS-GLN-ALA-ALA-SER- ILE-LYS-VA 123622-48-0 Fmoc-5-Ava-OH
124123-15-5 PACAP (1-38), amide, human, ovine, rat;HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2 124882-74-2 fa-gly-oh
125448-83-1 (Cys(AcM)2.7)-α-CGRP (huMan) 125692-40-2 Endothelin 3, human, rat;CTCFTYKDKECVYYCHLDIIW(Disulfidebridge:1-15and3-11)
126370-52-3 cAMP-Dependent Protein Kinase Inhibitor, PKI-tide;IAAGRTGRRQAIHDILVAA 127134-13-8 HIV Protease FRET Substrate I;DABCYL-GABA-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-EDANS
130587-39-2 IL-1β (208-240) (huMan) Interleukin-1β (208-240) (huMan) 131438-74-9 Beta-Amyloid (1-38);DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
131580-10-4 Beta-Amyloid (1-16);DAEFRHDSGYEVHHQK 132917-49-8 α-CGRP (30-37) (canine, Mouse, rat)
133565-46-5 Fmoc-Ile-ol 13512-59-9 Boc-Tyr(Bzl)-ONP
136625-03-1 Boc-Arg(Mts)-OH 141459-28-1 [Cys3,6, Tyr8, Pro9]-Substance P;RPCPQCFYPLM-NH2(Disulfidebridge:3-6)
142985-02-2 (β-Asp3)-GRF (huMan) (β-Asp3)-GHRH (huMan), (β-Asp3)-Growth HorMone-Releasing Factor (huMan), (β-Asp3)-Growth HorMone-Releasing HorMone (huMan), (β-Asp3)-SoMatocrinin (huMan), (β-Asp3)-SoMatoliberin (huMan), (β-Asp3)-SoMatorelin 142988-22-5 Renin FRET Substrate I;(DABCYL-g-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr-EDANS)
144409-99-4 Beta-Amyloid (40-1);VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD 146346-81-8 Fmoc-Ser(TBDMS)-OH

Total:8999 　Previous 1．．356 357 358 359 360 361 362．．375 Next

Contact the Supplier


CAS NO.：
* Purchase Request：

* Your Email：
* Requirements：	Quantity: Quality Standards: Packing: Place of Origin: Purity: Standard: Detailed Description:
* Name：
* Gender：	Male Female
* Country/Area：
* Company Name：
* Tel：	- - Country - Code Area - Code Number
* Explained in detail：

MSDS

MSDS are normally produced by the manufacturer of the product. So any customer can get the MSDS from the manufacturer/supplier of the product. Some universities and businesses have a collection somewhere on their website. We will give some internet-sources MSDS contain information on the properties of chemicals. Mainly they contain basic information to insure the safety and health of the user at all stages of its manufacture, storage, use and disposal.

MSDS Documents

SourcesDocuments

- 1.
- Sigma-Aldrich
  www.sigmaaldrich.com
- 2.
- Sigma-Aldrich
  www.sigmaaldrich.com
- 3.
- Umanitoba
  umanitoba.ca/faculties/science/microbiology/MSDS/Pyridoxine.pdf
- 4.
- Sigma-Aldrich
  www.sigmaaldrich.com
- 5.
- Basf
  www.performanceflooring.basf-cc.co.uk/en/products/System/Mastertop/PrimersforFlooringSystems/MASTERTOPP602/Documents/PART%20B%20MSDS.pdf
- 6.
- Sigma-Aldrich
  www.sigmaaldrich.com

Related Suppliers: GL Biochem(Shanghai)Ltd.; GL biochem（shanghai） Ltd; GL Biochem (Shanghai) Ltd.; Shanghai GL Peptide Ltd; GL Peptide (Shanghai) Co., Ltd.; Shanghai Union Biochem Co., Ltd.; Shanghai Dongyue Biochem Co., Ltd.,; GL&S Asia Co Ltd.; Shanghai Garden Biochem Technology Co.,LTD; Achiever Biochem Co., Ltd.; Mollt Biochem Co., Ltd; H&J BioChem Co., Ltd.; Shanghai ChemVia Co., Ltd; Shanghai Zabchem Co.,Ltd.; Shanghai Uchem Co., Ltd.; Shanghai Zealandchem Co., Ltd.; BETAPHARMA(SHANGHAI)CO.,LTD; Dynea (Shanghai) Co., Ltd.; GrowingChem (Shanghai) Co., Ltd.; Hotechem Shanghai Co., Ltd;

Company Information

Products

Contact the Supplier

MSDS

MSDS Documents