Home | Products | Suppliers | Post selling leads | MSDS Make Me Home | Page Add to Favorite
GL Biochem(Shanghai) Ltd
Home > Supplier Listing > G > GL Biochem(Shanghai) Ltd

Company Information

  • Company Name:

    GL Biochem(Shanghai) Ltd

  • Phone Number:86-21-61263452
  • Fax Number:86-21-61263399

Products

  • HATPPKKKRK, Biotinylated|Biotin-HATPPKKKRK HATPPKKKRK|HATPPKKKRK
  • H-AYPGKF-NH2 hBD-1, β-Defensin-1, human|DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK(Disulfidebridge:5-34,12-27,17-35)
  • hBD-3, β-Defensin-3, human|GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK(Disulfidebridge:11-40,18-33,23-41) hBD-4, β-Defensin-4, human|ELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRK(Disulfidebridge:6-33:13-27:17-34)
  • HBVpol455? HBV polymerase(455-463)|GLSRYVARL H-Cit-Ome.2HCl
  • H-CIT-PHE-OH H-Crt-2Cl(Trt)-Cl Resin
  • HCV Core Protein(1-20)??|MSTNPKPQRKTKRNTNRRPQ HCV NS3/4A Protease Substrate Hydrolysis Product 1|Ac-DE-Dap(QXL520)-EE-Abu
  • HCV NS3/4A Protease Substrate Hydrolysis Product 2|Lac-Ser-Cys(5-FAMsp)-NH2 HCV Protease Substrate(RET S1)|Ac-DE-D(Edans)-EE-Abu-ψ-[COO]-AS-K(Dabcyl)-NH2
  • HCV(Hepatitis C Virus) NS3/4A Protease Substrate|Ac-DE-Dap(QXL520)-EE-Abu-ψ-[COO]AS-C(5-FAMsp)-NH2 HCV, NS4A-Like Peptide??|KKGSVVIVGRIVLSGKPAIIPKK
  • HCV-1 E2 PROTEIN(484-499) HCV-1 E2 PROTEIN(554-569)
  • H-CYGRKKRRQRRR-NH2 H-Cys(Acm)-AMC.HCL
  • H-Cys(Acm)-NHME.HCL H-Cys(Acm)-NHME2.HCL
  • H-Cys(Acm)-OH.H2O H-Cys(Acm)-PNA.HCL

Contact the Supplier

 
CAS NO.:   
* Purchase Request:   
* Your Email:   
* Requirements:   
* Name:   
* Gender:    Male Female
* Country/Area:     
* Company Name:   
* Tel:    - -

Country - Code Area - Code Number

* Explained in detail:   

MSDS

MSDS are normally produced by the manufacturer of the product. So any customer can get the MSDS from the manufacturer/supplier of the product. Some universities and businesses have a collection somewhere on their website. We will give some internet-sources MSDS contain information on the properties of chemicals. Mainly they contain basic information to insure the safety and health of the user at all stages of its manufacture, storage, use and disposal.

MSDS Documents

SourcesDocuments
    • 1.
    • Hacco

      www.hacco.com/Cleaner_Disinfectants_MSDS/BioSentry_MSDS/Jamaica/MSDS%20BioSentry%20Longlife%20250S%20(Jamaica%20-%20English)%2004-09.pdf

    • 2.
    • Fisher Scientific

      fscimage.fishersci.com/msds/90138.htm

    • 3.
    • Sigma-Aldrich

      www.sigmaaldrich.com

    • 4.
    • Sigma-Aldrich

      www.sigmaaldrich.com

    • 5.
    • Georgia-Pacific

      w3.hantover.com/msds%5C89932%20Cormatic%20Aire%20Gels%20MSDS.pdf

    • 6.
    • Sigma-Aldrich

      www.sigmaaldrich.com

Related Suppliers: GL Biochem(Shanghai)Ltd.; GL biochem(shanghai) Ltd; GL Biochem (Shanghai) Ltd.; Shanghai GL Peptide Ltd; GL Peptide (Shanghai) Co., Ltd.; Shanghai Union Biochem Co., Ltd.; Shanghai Dongyue Biochem Co., Ltd.,; GL&S Asia Co Ltd.; Shanghai Garden Biochem Technology Co.,LTD; Achiever Biochem Co., Ltd.; Mollt Biochem Co., Ltd; H&J BioChem Co., Ltd.; Shanghai ChemVia Co., Ltd; Shanghai Zabchem Co.,Ltd.; Shanghai Uchem Co., Ltd.; Shanghai Zealandchem Co., Ltd.; BETAPHARMA(SHANGHAI)CO.,LTD; Dynea (Shanghai) Co., Ltd.; GrowingChem (Shanghai) Co., Ltd.; Hotechem Shanghai Co., Ltd;
Chemicals : A B C D E F G H I J K L M N O P Q R S T U V W X Y Z 0 1 2 3 4 5 6 7 8 9